4.65 Rating by CuteStat

lopeysminicraneservices.net is 4 years 4 months old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, lopeysminicraneservices.net is SAFE to browse.

PageSpeed Score
86
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 7
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

13.33.71.69

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Home | Lopey's Welding and Mini Crane Services

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 3 H4 Headings: 3
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 5
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 13.33.71.69)

Pittsburgh Association of Petroleum Geologists

- papgrocks.org
Not Applicable $ 8.95

Vermögensverwaltung und Family Office

- deutsche.wertpapiertreuhand.de

Die Deutsche Wertpapiertreuhand ist eine Vermögensverwaltung und ein Family Office. Wir sind einer der größten unabhängigen Vermögensverwalter Deutschlands.

Not Applicable $ 8.95


Fruit Ninja in virtual reality | Fruit Ninja VR for HTC Vive, Oculus a

- vr.fruitninja.com

Step into the Fruit Ninja universe and tackle fruit from all angles in one of virtual reality's most addicting games. Available now on Steam for HTC Vive, Oculus and PSVR

757,962 $ 1,680.00

Kids' Corner

- kidscorner.stagnesloretolko.com
1,497,328 $ 720.00

HTTP Header Analysis

HTTP/1.1 200 OK
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Date: Sun, 05 Jan 2020 19:10:23 GMT
Last-Modified: Sat, 28 Dec 2019 01:04:47 GMT
x-amz-version-id: MsmVR7y3v5t1o4HtCud8v9YsGtxT1YcJ
Server: AmazonS3
Content-Encoding: gzip
Vary: Accept-Encoding
X-Cache: Miss from cloudfront
Via: 1.1 e5af640ced3aa8764b82c4bc3f7af38e.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: HIO50-C1
X-Amz-Cf-Id: u-Omm--uh1mzkZMNNND21ddeawSu2R3RHVlrpg2PSyiaNRHiM2aVeQ==

Domain Information

Domain Registrar: Register.com, Inc.
Registration Date: Dec 11, 2019, 10:29 PM 4 years 4 months 2 weeks ago
Expiration Date: Dec 11, 2020, 10:29 PM 3 years 4 months 2 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
dns1.register.com 162.159.27.248 United States of America United States of America
dns2.register.com 162.159.26.197 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
d3re50v7trl3ph.cloudfront.net A 59 IP: 13.33.71.126
d3re50v7trl3ph.cloudfront.net A 59 IP: 13.33.71.26
d3re50v7trl3ph.cloudfront.net A 59 IP: 13.33.71.69
d3re50v7trl3ph.cloudfront.net A 59 IP: 13.33.71.117
d3re50v7trl3ph.cloudfront.net NS 172800 Target: ns-907.awsdns-49.net
d3re50v7trl3ph.cloudfront.net NS 172800 Target: ns-1519.awsdns-61.org
d3re50v7trl3ph.cloudfront.net NS 172800 Target: ns-1998.awsdns-57.co.uk
d3re50v7trl3ph.cloudfront.net NS 172800 Target: ns-125.awsdns-15.com
lopeysminicraneservices.net CNAME 3599 Target: lopeysweldingandminicraneservices.vivialsite.net
lopeysminicraneservices.net SOA 3600 MNAME: dns169.a.register.com
RNAME: root.register.com
Serial: 2019121102
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 3600
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:7600:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:8200:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:8a00:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:9400:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:a800:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:1800:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:2400:16:2fb1:4140:93a1
d3re50v7trl3ph.cloudfront.net AAAA 60 IPV6: 2600:9000:208d:2800:16:2fb1:4140:93a1

Full WHOIS Lookup

Domain Name: lopeysminicraneservices.net
Registry Domain ID: 2465890902_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.register.com
Registrar URL: http://www.register.com
Updated Date: 2019-12-11T16:44:03Z
Creation Date: 2019-12-11T16:44:03Z
Registrar Registration Expiration Date: 2020-12-11T16:44:03Z
Registrar: Register.com, Inc.
Registrar IANA ID: 9
Reseller:
Domain Status: clientTransferProhibited http://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domains Manager
Registrant Organization: Vivial - VSM
Registrant Street: 3100 Research BLVD
Registrant City: Dayton
Registrant State/Province: OH
Registrant Postal Code: 45420
Registrant Country: US
Registrant Phone: +1.8009012383
Registrant Phone Ext.:
Registrant Fax:
Registrant Fax Ext.:
Registrant Email: domains@vivial.net
Registry Admin ID:
Admin Name: Domains Manager
Admin Organization: Vivial - VSM
Admin Street: 3100 Research BLVD
Admin City: Dayton
Admin State/Province: OH
Admin Postal Code: 45420
Admin Country: US
Admin Phone: +1.8009012383
Admin Phone Ext.:
Admin Fax:
Admin Fax Ext.:
Admin Email: domains@vivial.net
Registry Tech ID:
Tech Name: Domains Manager
Tech Organization: Vivial - VSM
Tech Street: 3100 Research BLVD
Tech City: Dayton
Tech State/Province: OH
Tech Postal Code: 45420
Tech Country: US
Tech Phone: +1.8009012383
Tech Phone Ext.:
Tech Fax:
Tech Fax Ext.:
Tech Email: domains@vivial.net
Name Server: dns2.register.com
Name Server: dns1.register.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse@web.com
Registrar Abuse Contact Phone: +1.8773812449
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-01-05T19:10:34Z <<<

For more information on Whois status codes, please visit https: //www.icann.org/resources/pages/epp-status-codes-2014-06-16-en.

The data in Register.com's WHOIS database is provided to you by
Register.com for information purposes only, that is, to assist you in
obtaining information about or related to a domain name registration
record. Register.com makes this information available "as is," and
does not guarantee its accuracy. By submitting a WHOIS query, you
agree that you will use this data only for lawful purposes and that,
under no circumstances will you use this data to: (1) allow, enable,
or otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via direct mail, electronic mail, or by
telephone; or (2) enable high volume, automated, electronic processes
that apply to Register.com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of Register.com.
Register.com reserves the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.